General Information

  • ID:  hor002237
  • Uniprot ID:  A0A1I8N8J3(138-152)
  • Protein name:  kinin
  • Gene name:  101894080
  • Organism:  Musca domestica (House fly)
  • Family:  Kinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Musca (subgenus), Musca (genus), Muscini (tribe), Muscinae (subfamily), Muscidae (family), Muscoidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  NTVVLGKKQRFHSWG
  • Length:  15(138-152)
  • Propeptide:  MYFVRVSILVVFLCFYYCHARAEIRDLQTCESHLNKYRRFLLQAILNFEDICDAYNPRVVLAADNGLPPQMAFLGHYQPTEQKAETWTFLKLLMAQFNDMDFGNILRDAIIDRCHLKFQQQQQQQLIQQQQQRDEKRNTVVLGKKQRFHSWGGKRSGGLVTNDLDMEHNVDDVTMAY
  • Signal peptide:  MYFVRVSILVVFLCFYYCHARA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Diuretic and myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: diuretic:0.13 nM
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A1I8N8J3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002237_AF2.pdbhor002237_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 200692 Formula: C80H125N25O20
Absent amino acids: ACDEIMPY Common amino acids: GKV
pI: 11.82 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -71.33 Boman Index: -2864
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 64.67
Instability Index: 688.67 Extinction Coefficient cystines: 5500
Absorbance 280nm: 392.86

Literature

  • PubMed ID:  11897389
  • Title:  Diuretic and Myotropic Activities of N-terminal Truncated Analogs of Musca Domestica Kinin Neuropeptide